Protein Info for Dsui_0051 in Dechlorosoma suillum PS

Annotation: cob(II)yrinic acid a,c-diamide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 TIGR02476: 5,6-dimethylbenzimidazole synthase" amino acids 22 to 226 (205 residues), 280.7 bits, see alignment E=2.8e-88 PF00881: Nitroreductase" amino acids 35 to 201 (167 residues), 117.5 bits, see alignment E=3.7e-38

Best Hits

Swiss-Prot: 61% identical to BLUB_RHIME: 5,6-dimethylbenzimidazole synthase (bluB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K04719, 5,6-dimethylbenzimidazole synthase [EC: 1.14.99.40] (inferred from 71% identity to dia:Dtpsy_2528)

MetaCyc: 61% identical to aerobic 5,6-dimethylbenzimidazole synthase (Sinorhizobium meliloti)
RXN-8771 [EC: 1.13.11.79]

Predicted SEED Role

"Cobalamin biosynthesis protein BluB @ 5,6-dimethylbenzimidazole synthase, flavin destructase family"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.79 or 1.14.99.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLE7 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Dsui_0051 cob(II)yrinic acid a,c-diamide reductase (Dechlorosoma suillum PS)
MKTDPTVNKVISLAGYQNEHEFSDAARDAIYHAIFSRRDVRGQFLPDPVPQEVLARVLTA
AHFAPSVGYMQPWSFLLVREAETKARIHAAFQQANQEAAEKFEGERQAIYKELKLEGIRE
APINLLITCDRDRAGPVVIGRTHIKAMDLYSSVCAVQNLWLAARSEGLGVGWVSIFHQQA
LRDILGLPPRIIPVAYLCLGYVSHFKEKPELESAGWRQRLPLADLVYDGQWEKPVEEELR
QVLSEHQARAQEKRRF