Protein Info for Dsui_0049 in Dechlorosoma suillum PS

Annotation: uncharacterized membrane-anchored protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 365 to 385 (21 residues), see Phobius details amino acids 401 to 418 (18 residues), see Phobius details PF11902: DUF3422" amino acids 7 to 424 (418 residues), 539.2 bits, see alignment E=4.1e-166

Best Hits

KEGG orthology group: None (inferred from 64% identity to azo:azo2872)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLE5 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Dsui_0049 uncharacterized membrane-anchored protein (Dechlorosoma suillum PS)
MTLPLAEHPLRQRLNDEVHARPPMALEGPEWISYLAVLHEGTEAAAEEAHLQRLCAALGA
NLCPVIQGDHWVMDAGRLRLKWERHNEFSGYTFFLAREPGDAPDTTAISALPADWLAGLP
GSVMVATHVEFRSAADLDPEELLADLHRSGDSWVATTVADGAAWVASDFQLHDGWSRFLV
LDERLRHRQAGRTVQRLLEIETYRMMALLAFPVAKEVSRLLARAEGEVADLMDRMGEARG
PEDERLLLARLTRLAAEIERSVTRTAFRFGAAEAYYALVQQRVRELREHRLNGFPPISEF
MDRRLAPAINTCLSVARRQTDLSTRIARKSALLRTRVDIELERQNQQLLGQMNRRAKLQL
RLQETVEGLSVVAITYYASQLVSYLAKGLSKTVLPHLSPEIASAVSIPLIAAVVAVSIRR
MRRALAAEELEQGEGH