Protein Info for Dsui_0038 in Dechlorosoma suillum PS

Annotation: HIT family hydrolase, diadenosine tetraphosphate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 PF11969: DcpS_C" amino acids 3 to 104 (102 residues), 40.7 bits, see alignment E=3.1e-14 PF01230: HIT" amino acids 12 to 107 (96 residues), 83.3 bits, see alignment E=1.6e-27

Best Hits

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 59% identity to del:DelCs14_4542)

Predicted SEED Role

"Histidine triad (HIT) nucleotide-binding protein, similarity with At5g48545 and yeast YDL125C (HNT1)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLD4 at UniProt or InterPro

Protein Sequence (136 amino acids)

>Dsui_0038 HIT family hydrolase, diadenosine tetraphosphate hydrolase (Dechlorosoma suillum PS)
MNQTVFSRIINGELPCAKVYEDGHVFAFMDAGQVNPGHVLVVSKKPFETLLDADEETAAA
LMRAARKIALAVQDAFGPEGITILQANRPQGWQTVPHLHLHVLPRHAGDGVGLVWPRKEP
GLEQLQTLAAKIKVTD