Protein Info for Dsui_0037 in Dechlorosoma suillum PS

Annotation: putative acyl-CoA transferase/carnitine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF02515: CoA_transf_3" amino acids 12 to 380 (369 residues), 414.9 bits, see alignment E=1.6e-128

Best Hits

Swiss-Prot: 51% identical to SCCT_CHLAA: Succinyl-CoA--D-citramalate CoA-transferase (Caur_2266) from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)

KEGG orthology group: K07749, formyl-CoA transferase [EC: 2.8.3.16] (inferred from 80% identity to tmz:Tmz1t_0856)

Predicted SEED Role

"L-carnitine dehydratase/bile acid-inducible protein F (EC 2.8.3.16)" (EC 2.8.3.16)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKS4 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Dsui_0037 putative acyl-CoA transferase/carnitine dehydratase (Dechlorosoma suillum PS)
MSPAASCPPKPLAGLKVVELGTLIAGPFASRLLAEFGAEVVKIESPDGGDPLRKWRKLYE
GTSLWWFVQSRNKQSVTVNLKHPQGRDIVRKLVAEADIVVENFRPGVMEKLGLSWEELSA
LNPGLVMLRLSGFGQTGPYKDQPGFGAVGESMGGLRYITGFADRPPVRTGISIGDSIAAL
WGVFGTLMALRHKEVQGGKGQVVDVALYEAIFAMMESLVPEFDVFGFVRERTGNIMPGIT
PSNTHKTRDGKFVTIGANGDAIFQRLMRALGREDLATDPGLADNAGRDGRRDEVYALIDA
WVAGLDEAELLAKLEAAEVPASRVYSVADMFADPQFLAREMIQSARLPDGKDFKVPGIVP
KLSATPGGTEWLGPGLGEHTEAVLTRLGYDAEAIAALREAGAI