Protein Info for Dsui_0027 in Dechlorosoma suillum PS

Annotation: putative effector of murein hydrolase LrgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 45 (17 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details PF03788: LrgA" amino acids 12 to 104 (93 residues), 94.3 bits, see alignment E=1.8e-31

Best Hits

KEGG orthology group: None (inferred from 64% identity to dar:Daro_3105)

Predicted SEED Role

"Antiholin-like protein LrgA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKR4 at UniProt or InterPro

Protein Sequence (120 amino acids)

>Dsui_0027 putative effector of murein hydrolase LrgA (Dechlorosoma suillum PS)
MLAALTQLLLFQLAGEVIAHGLGISVPGPVIGMVLLFAFLVLCQGPGHDLQHTSQNLLAH
LSLLFVPAGTGVMLHLHRLQDEWLPILLSLLLSTAVTLALTGLLLKALSRRAAPGGETRP