Protein Info for Dsui_0026 in Dechlorosoma suillum PS

Annotation: CBS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 46 (16 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 131 to 156 (26 residues), see Phobius details PF01595: CNNM" amino acids 5 to 196 (192 residues), 134.9 bits, see alignment E=3.8e-43 PF03471: CorC_HlyC" amino acids 347 to 426 (80 residues), 86.8 bits, see alignment E=1.2e-28

Best Hits

KEGG orthology group: K03699, putative hemolysin (inferred from 76% identity to dar:Daro_3215)

Predicted SEED Role

"Hemolysin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKR3 at UniProt or InterPro

Protein Sequence (428 amino acids)

>Dsui_0026 CBS domain-containing protein (Dechlorosoma suillum PS)
MDIWILVFLVLSSGLLSLAEMAVGASRNSHLAMLAEEGSLGAGTVLRFRQHPSRLLATTQ
LGITALAMLSGVFGESLWVPRAEEWLRQSLGLGDSLAYGLALGGVVTVITFFTLVFGEVV
PKRLALAKPEATAVALAGTVVWLLRLSRPLVWIVSWVSDRILDLFPSKGSAEASAADEIR
FLIESGRKEGVLDQTESEILGNVFRLDNRRVGAIMTPATGIAYLDLTLPREANMKVLQER
AVSRFLVCKGGLGTPLGFVEGRELLQALLRDGSLDFGKLSPNAPFYVPNSLSLIGLLEFF
KANQTQIALVVNEFGGTEGLVTLSDLMGTVVGDVLSGAVEAPMALQRSDGSWLLDGLLPI
DELKELLGLAELPEEELGNYHTVGGFVVYQLGRIPKKTESFEWAGWRFEVMDMEKNRVDE
VLAKRLEP