Protein Info for Dsui_0020 in Dechlorosoma suillum PS

Annotation: HAD-superfamily subfamily IIA hydrolase, TIGR01458

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR01458: HAD hydrolase, TIGR01458 family" amino acids 18 to 266 (249 residues), 252.6 bits, see alignment E=3.7e-79 PF13344: Hydrolase_6" amino acids 20 to 96 (77 residues), 67.8 bits, see alignment E=1.1e-22 PF00702: Hydrolase" amino acids 120 to 226 (107 residues), 31.1 bits, see alignment E=4.8e-11 PF13242: Hydrolase_like" amino acids 186 to 258 (73 residues), 72.3 bits, see alignment E=3.8e-24

Best Hits

Swiss-Prot: 50% identical to HDHD2_BOVIN: Haloacid dehalogenase-like hydrolase domain-containing protein 2 (HDHD2) from Bos taurus

KEGG orthology group: None (inferred from 67% identity to dar:Daro_4161)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKQ7 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Dsui_0020 HAD-superfamily subfamily IIA hydrolase, TIGR01458 (Dechlorosoma suillum PS)
MAEPDPVPSAPPLPQKPRAVLIDLAGVLHVGDRPVPGAAAALQRLRASGLPLRFLTNTTR
SPRQALVQLLHSMGLAVAPEEIQTAVRATAQLVRQRGLHPHYLVHPAIADEVGPSHPEPD
AVVLGDAGEHFTFDALNRAFRLLQAGCPLIAMARNRYFQEPDGLTLDLGAFVAALEYGAG
VRAEVVGKPAAPFFLGALAELGVVPGEAVLIGDDLRDDIGGAQAVGMPGVLVRTGKFRPA
DESAGDIRAARVVDDFAAAVALLLGH