Protein Info for Dsui_0019 in Dechlorosoma suillum PS

Annotation: malate synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20656: MS_N
  • amino acids 8 to 70 (63 residues), 86.2 bits, E=1.3e-28
• TIGR01344: malate synthase A
  • amino acids 22 to 531 (510 residues), 743.2 bits, E=5.6e-228
• PF01274: MS_TIM-barrel
  • amino acids 161 to 394 (234 residues), 337.9 bits, E=4e-105
• PF20659: MS_C
  • amino acids 411 to 530 (120 residues), 124.4 bits, E=5e-40

Best Hits

Swiss-Prot: 58% identical to MASY_EMENI: Malate synthase, glyoxysomal (acuE) from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

KEGG orthology group: K01638, malate synthase [EC: 2.3.3.9] (inferred from 89% identity to dar:Daro_3101)

Predicted SEED Role

"Malate synthase (EC 2.3.3.9)" in subsystem Photorespiration (oxidative C2 cycle) (EC 2.3.3.9)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• glyoxylate cycle (6/6 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• glycolate and glyoxylate degradation II (2/2 steps found)
• chitin deacetylation (2/4 steps found)
• superpathway of glycol metabolism and degradation (4/7 steps found)
• L-arabinose degradation IV (2/8 steps found)
• D-xylose degradation IV (1/7 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (3/14 steps found)
• superpathway of pentose and pentitol degradation (5/42 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.9

Sequence Analysis Tools

See G8QKQ6 at UniProt or InterPro

Protein Sequence (532 amino acids)

>Dsui_0019 malate synthase A (Dechlorosoma suillum PS)
MSLNLPAGMQITAPIQPQYESILTLEALEFVAKLHRAFEGRRQELLKARVERQARIDAGE
MPDFLPETKHIREGDWKVAPLPAALERRRTEITGPVEAKMIINAFNSGADSYMTDFEDSN
SPNWDNQIQGQVNLYQAIRRQLSFKNEAGKEYKLNDQIATLQIRPRGWHLDEKHVTVDGQ
RVAGGIFDFALVFFHNAKEQIARGAGPFYYLPKMESHLEARLWNDIFVMAQDHIGLPQGT
IKATVLVETILATFEMEEILYELRNHSAGLNAGRWDYIFSCIKKFKKNKDFCLAQRGVIT
MEVPFMRSYALALVQACHKRGAPAMGGMSALIPIKNDPVANEKALAGIRHDKARDAKDGF
DGGWVAHPGLVSIAHEEFVKVLGDKPNQWEKQVEGSFGPKDWLNFQPEQPITEAGLRNNI
NVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWVVSPKGILDDGRKVTVEMVRP
MIAEELAKVKATVAAQGEDTATYDQAAVIFDKMSLTPDYPEFLTLPLYEAMA