Protein Info for Dsui_0014 in Dechlorosoma suillum PS

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 146 to 162 (17 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details PF03458: Gly_transporter" amino acids 5 to 78 (74 residues), 74.4 bits, see alignment E=2.6e-25 amino acids 90 to 163 (74 residues), 82.2 bits, see alignment E=9.8e-28

Best Hits

KEGG orthology group: None (inferred from 82% identity to azo:azo1116)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKQ1 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Dsui_0014 putative membrane protein (Dechlorosoma suillum PS)
MLITIYLIAITAEAMSGALAAGRRNMDIFGVAFIAFVTALGGGTIRDMVLGHFPIGWTQH
PPYIYLVISAGLVTTLFARFMHHLKTVFLVLDALGLIAFSLIGCEVALGMGYAPVVVIMA
GMITGIFGGILRDVLCNQVPVVFRQELYASVSLAVCSLYLVLRDLGLGTEANTLISFGLG
LALRLCAIWRGWKLPTFSYRQRWD