Protein Info for Dsui_0011 in Dechlorosoma suillum PS

Annotation: isocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 TIGR01346: isocitrate lyase" amino acids 9 to 256 (248 residues), 359.8 bits, see alignment E=1.1e-111 amino acids 257 to 435 (179 residues), 277.3 bits, see alignment E=1.1e-86 PF00463: ICL" amino acids 13 to 256 (244 residues), 205 bits, see alignment E=2e-64 amino acids 258 to 435 (178 residues), 173.3 bits, see alignment E=8e-55 PF13714: PEP_mutase" amino acids 68 to 280 (213 residues), 53.8 bits, see alignment E=2.1e-18

Best Hits

Swiss-Prot: 72% identical to ACEA_ECOL6: Isocitrate lyase (aceA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 94% identity to del:DelCs14_2193)

MetaCyc: 72% identical to isocitrate lyase (Escherichia coli K-12 substr. MG1655)
Isocitrate lyase. [EC: 4.1.3.1]

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKP8 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Dsui_0011 isocitrate lyase (Dechlorosoma suillum PS)
MSTREQQIAALEKDWAENPRWKGVKRGYSAADVVRLRGSLQPEYTFAQRGAKVLWEKVNG
GAKKGYVNAFGAITAGQAMQQAKAGLEAVYLSGWQVAADGNTSETMYPDQSLYAYDSVPT
MVRRINNTFKRADEIQWSRGINPGDKEFIDYFLPIVADAEAGFGGVLNAFELMKNMIAAG
AAGVHFEDQLAAAKKCGHMGGKVLVPTREAVEKLISARFAADVMGVPTLILARTDAEAAN
LITSDYDANDKPFLTGERTQEGFFRVKNGLEQSISRGVAYAPYADLVWCETGVPDIGFAR
EFAQAVHAACPGKLLSYNCSPSFNWKKNLNDSQIASFQEELSALGYKYQFITLAGIHVNW
YNTFKFAKAYAGGEGMKHYVEMVQEPEFAAREDGYTFVSHQQEVGTGYFDDVTTVIQGGS
SSVKALTGSTEEEQFH