Protein Info for Dsui_0011 in Dechlorosoma suillum PS

Annotation: isocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01346: isocitrate lyase
  • amino acids 9 to 256 (248 residues), 359.8 bits, E=1.1e-111
  • amino acids 257 to 435 (179 residues), 277.3 bits, E=1.1e-86
• PF00463: ICL
  • amino acids 13 to 256 (244 residues), 205 bits, E=2e-64
  • amino acids 258 to 435 (178 residues), 173.3 bits, E=8e-55
• PF13714: PEP_mutase
  • amino acids 68 to 280 (213 residues), 53.3 bits, E=3.1e-18

Best Hits

Swiss-Prot: 72% identical to ACEA_ECOL6: Isocitrate lyase (aceA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 94% identity to del:DelCs14_2193)

MetaCyc: 72% identical to isocitrate lyase (Escherichia coli K-12 substr. MG1655)
Isocitrate lyase. [EC: 4.1.3.1]

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• glyoxylate cycle (6/6 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

See G8QKP8 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Dsui_0011 isocitrate lyase (Dechlorosoma suillum PS)
MSTREQQIAALEKDWAENPRWKGVKRGYSAADVVRLRGSLQPEYTFAQRGAKVLWEKVNG
GAKKGYVNAFGAITAGQAMQQAKAGLEAVYLSGWQVAADGNTSETMYPDQSLYAYDSVPT
MVRRINNTFKRADEIQWSRGINPGDKEFIDYFLPIVADAEAGFGGVLNAFELMKNMIAAG
AAGVHFEDQLAAAKKCGHMGGKVLVPTREAVEKLISARFAADVMGVPTLILARTDAEAAN
LITSDYDANDKPFLTGERTQEGFFRVKNGLEQSISRGVAYAPYADLVWCETGVPDIGFAR
EFAQAVHAACPGKLLSYNCSPSFNWKKNLNDSQIASFQEELSALGYKYQFITLAGIHVNW
YNTFKFAKAYAGGEGMKHYVEMVQEPEFAAREDGYTFVSHQQEVGTGYFDDVTTVIQGGS
SSVKALTGSTEEEQFH