Protein Info for Dsui_0008 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF02617: ClpS" amino acids 22 to 100 (79 residues), 126 bits, see alignment E=2e-41

Best Hits

Swiss-Prot: 76% identical to CLPS_NITMU: ATP-dependent Clp protease adapter protein ClpS (clpS) from Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)

KEGG orthology group: K06891, ATP-dependent Clp protease adaptor protein ClpS (inferred from 76% identity to nmu:Nmul_A2247)

Predicted SEED Role

"ATP-dependent Clp protease adaptor protein ClpS" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKP5 at UniProt or InterPro

Protein Sequence (105 amino acids)

>Dsui_0008 hypothetical protein (Dechlorosoma suillum PS)
MAIQHENNQGSVALEKKSSKVKPPPMYKVLLLNDDFTPMDFVILVLQKFFAKDREQATRI
MLKVHNEGRGLCGVYPRDIAATKVDQVVAFARQHQHPLVCVMEEN