Protein Info for CSW01_19540 in Vibrio cholerae E7946 ATCC 55056

Annotation: chemotaxis protein CheW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF01584: CheW" amino acids 5 to 141 (137 residues), 115.8 bits, see alignment E=5.9e-38

Best Hits

Swiss-Prot: 35% identical to CHEW_RHIEC: Probable chemotaxis protein CheW (cheW) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K03408, purine-binding chemotaxis protein CheW (inferred from 100% identity to vcm:VCM66_A1050)

Predicted SEED Role

"Positive regulator of CheA protein activity (CheW)" in subsystem Bacterial Chemotaxis or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>CSW01_19540 chemotaxis protein CheW (Vibrio cholerae E7946 ATCC 55056)
MMQREFLSFVLDDEEYGIPILEVREVRGWSPVRILPNAPPFVIGLLDIRGEYIPIVDLKR
RLGLVPVEINATTVVVVINAANQQPLGLIVDAVAEVYALSEQEIKHAPSISTVIGNQYVK
GIAAVKSKHLVLIDIDALFDVEALRLSTTAESI