Protein Info for CSW01_19535 in Vibrio cholerae E7946 ATCC 55056

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 PF13188: PAS_8" amino acids 40 to 90 (51 residues), 19.2 bits, see alignment 2.3e-07 PF13426: PAS_9" amino acids 179 to 281 (103 residues), 15.3 bits, see alignment E=5e-06 PF18947: HAMP_2" amino acids 311 to 372 (62 residues), 46 bits, see alignment 1e-15 PF00672: HAMP" amino acids 326 to 374 (49 residues), 31.4 bits, see alignment 4.9e-11 PF00015: MCPsignal" amino acids 439 to 594 (156 residues), 183.5 bits, see alignment E=8.1e-58

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to vch:VCA1092)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (678 amino acids)

>CSW01_19535 methyl-accepting chemotaxis protein (Vibrio cholerae E7946 ATCC 55056)
MAFWNRKQQVVPQFVEPAKESATSEFDESETQSGLSNYQLLSALNAAQTALMMIDRDFRI
TYFNNQTLKLLKQHETLFRSVWPDFRAEADFLHGYCIDHFHLNPRHQRTMLADPSHLPYT
TVINIKGVKIELIVGAIIDDRGSYIGNTLEWRDVTEELLRDQQIGRLASAVEGMTTNLMM
ADKEGIIQYLNPALLQLLTHREPELAQAFPGFKAAELVGKNIDIFHKNPAHQRSIISNPE
RLPFTSMIKVGSLEFNLTCIAMRDTKGEYIGPALQWVDITEQRDGQRQVESLIQKAIKGD
LHDRINTSGYNGFMRELGDGINNLLNTLVEPLGQCITVMSRVAEGDLNTSMSEEYQGEFG
RLASAVNASIVNLRNMVDKITVSSARVATASTEIADGNNDLSQRVEAQASNLEETAASME
EITATVRQNADNAKDANLLATDAAKKAARGGEVVGEAISAMGAINTASKKIADIISVIDE
IAFQTNLLALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAGAAKEIKGLINDSVDKVNE
GSRLVNESGSTLKEIVEAVVRVSDLIAQIAASSVEQSTGIDEINRAIAAMDEMTQQNASL
VEETSAASQSLKDEGKELLNLMNFFVTENNVTTFERKPRQSTPPKTKPVVSMHKAPINQA
VHKMPARAAEEGDEWEEF