Protein Info for CSW01_19520 in Vibrio cholerae E7946 ATCC 55056

Annotation: chemotaxis response regulator protein-glutamate methylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF00072: Response_reg" amino acids 6 to 111 (106 residues), 86.7 bits, see alignment E=1.2e-28 PF01339: CheB_methylest" amino acids 158 to 335 (178 residues), 193.5 bits, see alignment E=2.6e-61

Best Hits

Swiss-Prot: 67% identical to CHEB2_VIBVU: Protein-glutamate methylesterase/protein-glutamine glutaminase 2 (cheB2) from Vibrio vulnificus (strain CMCP6)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 100% identity to vco:VC0395_0154)

MetaCyc: 46% identical to protein-glutamate methylesterase/protein glutamine deamidase (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>CSW01_19520 chemotaxis response regulator protein-glutamate methylesterase (Vibrio cholerae E7946 ATCC 55056)
MKKIKVLIVDDSPVFRALLTQLIDSDPALQVVASAEDPYQARELIKHYQPDVVTLDVEMP
KMNGVQFLKNLMRLHPLPVVMISTLTQHGAEATLAALELGAVDYFPKPSSDNPAEMLNYK
NLVNDKIKMAAQANVGFVQSATVSAPITERVSTDYQLIAIGSSTGGTEAVKQVLAALPSG
LPPIVMTQHIGAQFTASLAKRLNDSSALHVQEVTQPTTALESSCAYLAPGDKHIVVVKRA
GKLYVELDDRPAVNRHKPSVDVMFNSIAQHVGSKAMGILLTGMGQDGAKGMLAMHQQGAA
TAAQDEQSSVVWGMPRVAIELGAADVVKPLGAMATWIVEQLQKKHA