Protein Info for CSW01_19475 in Vibrio cholerae E7946 ATCC 55056

Annotation: pyridoxine/pyridoxamine 5'-phosphate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 TIGR00558: pyridoxamine 5'-phosphate oxidase" amino acids 1 to 211 (211 residues), 296.2 bits, see alignment E=6.9e-93 PF01243: PNPOx_N" amino acids 32 to 158 (127 residues), 94.1 bits, see alignment E=8.1e-31 PF10590: PNP_phzG_C" amino acids 171 to 211 (41 residues), 74.3 bits, see alignment 5.6e-25

Best Hits

Swiss-Prot: 100% identical to PDXH_VIBCH: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 100% identity to vco:VC0395_0163)

MetaCyc: 66% identical to pyridoxine/pyridoxamine 5'-phosphate oxidase (Escherichia coli K-12 substr. MG1655)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>CSW01_19475 pyridoxine/pyridoxamine 5'-phosphate oxidase (Vibrio cholerae E7946 ATCC 55056)
MDLSDIRREYIHGGLRRKDLQANPIDQFNLWLQQAIDANLSDPTAMTVATVDEHGQPFQR
IVLLKNVDDAGFVFYTNLGSRKAQHIAHNNKISLHFPWHPLERQVHITGVAEKLTAMENM
KYFMSRPKESQIAAIASHQSSRISARGVLEGKYLELKQKFANGEIPVPSFWGGYRIRPES
LEFWQGGEHRLHDRFLYSRQDDNWTVDRLAP