Protein Info for CSW01_19430 in Vibrio cholerae E7946 ATCC 55056

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 285 to 307 (23 residues), see Phobius details PF02743: dCache_1" amino acids 96 to 270 (175 residues), 60.5 bits, see alignment E=3.9e-20 PF22673: MCP-like_PDC_1" amino acids 107 to 187 (81 residues), 41.4 bits, see alignment E=3.6e-14 PF00672: HAMP" amino acids 306 to 359 (54 residues), 40.4 bits, see alignment 6e-14 PF00015: MCPsignal" amino acids 439 to 605 (167 residues), 143.2 bits, see alignment E=1.5e-45

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to vco:VC0395_0173)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (639 amino acids)

>CSW01_19430 methyl-accepting chemotaxis protein (Vibrio cholerae E7946 ATCC 55056)
MQFDMNGVLFMRLSLKRKMVFSVVVAIAVTAAALVAAGYQTFEKDSWRAIESESRNTLQA
HAKGIGDWFLGKQLALKGLREEIERNPQLELVPHLRQTLQSGSFGLSYYGNEQGEMFRQD
PSLNTADYDPRVRGWYKEAKAAGKPITTEPYVSVTMQTLVVTLAEPVRYQGQLIGVAASN
LALDKLIKDVLAIEVPGKGYAILVNQKGKIVAHPTQDLILKPTEEMSAQLTISKLNIAAK
DHSLFQLSMDGRDKVLMAEEVANTDWLLVMVMDKGVLEQPLNDMLMVQIGIGLGILLVMA
LLTSWFVARQLNELGNIANALADIAEGDGDLTRRLDVRSQDEVGLLADKFNKFVDRLHQM
VKNVREVSVALTQGADHAAASATQASKRIRTQQDEITMVATAVTEMASATAEIASNAENT
AKNATQSVQLGEDGFAQMQQSKQSIDQLAQELTGAVRIISELEVHANEISTILSTIRGIA
EQTNLLALNAAIEAARAGEQGRGFAVVADEVRVLSQRTHASTEEIQTKIAGLQKVTTTAV
SVMTESHKLVETSVADVNQTGASLQAISEAIQQISDMATQIASAAEEQSLVTADINVNTE
SVREVSDQLAEEAQQSVQQAKSLHAMAQELNKEISRFKL