Protein Info for CSW01_19390 in Vibrio cholerae E7946 ATCC 55056

Annotation: 3,4-dihydroxy-2-butanone-4-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 TIGR00506: 3,4-dihydroxy-2-butanone-4-phosphate synthase" amino acids 14 to 210 (197 residues), 257.7 bits, see alignment E=3.4e-81 PF00926: DHBP_synthase" amino acids 18 to 209 (192 residues), 274.5 bits, see alignment E=2e-86

Best Hits

Swiss-Prot: 100% identical to RIBB_VIBCM: 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K02858, 3,4-dihydroxy 2-butanone 4-phosphate synthase [EC: 4.1.99.12] (inferred from 100% identity to vcj:VCD_000280)

MetaCyc: 67% identical to 3,4-dihydroxy-2-butanone-4-phosphate synthase (Escherichia coli K-12 substr. MG1655)
3,4-dihydroxy-2-butanone-4-phosphate synthase. [EC: 4.1.99.12]

Predicted SEED Role

"3,4-dihydroxy-2-butanone 4-phosphate synthase (EC 4.1.99.12)" (EC 4.1.99.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.99.12

Use Curated BLAST to search for 4.1.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>CSW01_19390 3,4-dihydroxy-2-butanone-4-phosphate synthase (Vibrio cholerae E7946 ATCC 55056)
MNQSSLLAEFGDPITRVENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTAQMALMI
RECSGIVCLCLTEAQADRLALPPMVVNNNSANQTAFTVSIEAKHGVTTGVSAQDRVTTIK
TAANPQAKPEDLARPGHVFPLRARAGGVLARRGHTEGTVDLMQMAGLQPAGVLCELTNPD
GSMAKTPEIIEFGKLHNMPVLTIEDMVQYRIQFDLKLA