Protein Info for CSW01_19350 in Vibrio cholerae E7946 ATCC 55056

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 9 to 38 (30 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 163 to 180 (18 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details PF01925: TauE" amino acids 12 to 232 (221 residues), 116.6 bits, see alignment E=7.1e-38

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to vcm:VCM66_A1010)

Predicted SEED Role

"FIG01199795: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>CSW01_19350 sulfite exporter TauE/SafE family protein (Vibrio cholerae E7946 ATCC 55056)
MEYLGASAWIAMLLVFMGSFVQTAIGFGLAVVASPLLFLISPDYVPSPICLVALFISVLN
AMKHRESISIGGLKMALIGRIPGSIVGGLLLMWISTQALALWLGLLVLFAVAVSLLPLRI
EPNPTRMGIAGFFSGVFGTSSGIGGPPMALLLQHQEANQLRGNLSAFFVFSSIISLMVQW
PTGFLTWHHVLLTLPLIPAAWLGYVLARKTTHSLPKEKIRFAALALCLVSGATAVWHGFF