Protein Info for CSW01_19290 in Vibrio cholerae E7946 ATCC 55056

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 62 to 131 (70 residues), 50.4 bits, see alignment E=1.3e-17 PF00528: BPD_transp_1" amino acids 84 to 291 (208 residues), 74 bits, see alignment E=6.8e-25

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to vcm:VCM66_A0998)

Predicted SEED Role

"amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>CSW01_19290 amino acid ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MNNYGAKSSSGYRFTLLDGGLLLAIASLIGWLYYRSEVGIHYQWHWREAWTLIFTPRADG
SLPYFLQGLGATLRLSLWGMVLALVLGSLIGIARSQKAWFVRLPANAFVQLVRNIPPLVF
VFIFYFFISNQLIPLLGLDELLRYHTAEVHPLITWLFGPARLWENLLSGVLCIGLLSSAY
IAEIVRAGLANIPQGQWEAADSLGLPTWGKYRYVIAPQVLTAITPALAGQTISLIKDTSI
ISLISIQELTFVGSEIANSSGLIFEIWLIVGAAYLVLCLTLSMLFKQVEKRSLRHLSR