Protein Info for CSW01_19065 in Vibrio cholerae E7946 ATCC 55056

Annotation: ATP-dependent helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 PF00270: DEAD" amino acids 47 to 207 (161 residues), 151.7 bits, see alignment E=2.5e-48 PF04851: ResIII" amino acids 63 to 183 (121 residues), 29.9 bits, see alignment E=7.5e-11 PF00271: Helicase_C" amino acids 245 to 353 (109 residues), 95.3 bits, see alignment E=4.2e-31

Best Hits

Swiss-Prot: 43% identical to RHLE_ECOLI: ATP-dependent RNA helicase RhlE (rhlE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_A0949)

MetaCyc: 43% identical to ATP-dependent RNA helicase RhlE (Escherichia coli K-12 substr. MG1655)
5.6.2.e [EC: 5.6.2.e]

Predicted SEED Role

"ATP-dependent RNA helicase VCA0990" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.6.2.e

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>CSW01_19065 ATP-dependent helicase (Vibrio cholerae E7946 ATCC 55056)
MIKSTPAIIRPTLFFEYSGIQPMSFSSLALSADLIQALPKAITEPSAIQTLVIPAMLTGK
DVFALANTGSGKTLAYGLPLLERLKTSPEQQALVLVPTRELAMQVSEVLTHVGTALGLNT
LCLCGGVDKTEQQNALAENPNILVATTGRLFDLTQSGLRLNRVTTLVLDEADRLLDMGFW
PQVQALASQTAGVRQTVMCSATFSDDLKLKAQQLMRAPTQVSANPENSINQAVQETLYLV
NKGSKTQALVALLKQHQWPQVLVFIGAKENADSLTKKLNKAGIVATVLHGDKSQSEREAA
LAEFKNGTTQVLIATDLLARGIHIELLPVVINFELPMHAETYVHRVGRTARAGQHGIALS
LVCHGEMDALNATRTLTQRELPVQNLEGFPVTDQPSTGESKRAPRDKQANRRTQNKKSVK
QFQGKSRT