Protein Info for CSW01_19060 in Vibrio cholerae E7946 ATCC 55056

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 signal peptide" amino acids 19 to 20 (2 residues), see Phobius details transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 380 to 404 (25 residues), see Phobius details amino acids 410 to 429 (20 residues), see Phobius details PF01554: MatE" amino acids 20 to 180 (161 residues), 79.9 bits, see alignment E=9.3e-27 amino acids 239 to 390 (152 residues), 59.5 bits, see alignment E=1.7e-20 TIGR00797: MATE efflux family protein" amino acids 20 to 408 (389 residues), 175.1 bits, see alignment E=1.1e-55

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_0249)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>CSW01_19060 MATE family efflux transporter (Vibrio cholerae E7946 ATCC 55056)
MYMQTSTSSLAKQLFQMTWPMLFGVLSLMSFQLVDSAFIGQLGVLPLAAQGFTMPIQMVI
IGIQVGLGIATTAVISRAIGAGKTEYAKQLGGLVIVIGGIGVALIALVLYLLRQPLLGLL
GAPETVFAIIDHYWLWWLASAWTGAMLYFYYSVCRANGNTLLPGTLMMVTSVLNLILDPI
FIFTFDLGIDGAAIATIIAFGVGIAIVAPKVAQRQWTSYQWQDLNISQSLTALGHIMGPA
MLSQLLPPLSSMFATKLLASFGTAAVAAWALGSRFEFFALVAVLAMTMSLPPMIGRMLGA
KEITHIRQLVRIACQFVLGFQLLIALVTYVFATPLAELMTSETEVSQILNLHLVIVPISL
GALGICMLMVSVANALGKSYVALTISALRLFAFYLPCLWLGAHFYGIEGLFIGALVGNII
AGWAAWLAYQKALRQLEGAHHTSA