Protein Info for CSW01_19055 in Vibrio cholerae E7946 ATCC 55056

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 transmembrane" amino acids 149 to 166 (18 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 24 to 111 (88 residues), 40.8 bits, see alignment E=1.1e-14 PF13426: PAS_9" amino acids 27 to 110 (84 residues), 35.5 bits, see alignment E=2e-12 PF00989: PAS" amino acids 30 to 107 (78 residues), 24.6 bits, see alignment E=4.3e-09 PF08447: PAS_3" amino acids 31 to 114 (84 residues), 73.9 bits, see alignment E=2.1e-24 PF00015: MCPsignal" amino acids 299 to 483 (185 residues), 141.7 bits, see alignment E=4.5e-45

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to vcm:VCM66_A0947)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>CSW01_19055 chemotaxis protein (Vibrio cholerae E7946 ATCC 55056)
MRNNQPVTQKEVTYPPHFNLLSTTTLSSHIKYASKEFCDVAGYTLDELVNQPHNMVRHPD
MPPEAFKDMWEHLKAGKSWMGMVKNRCKNGDHYWVDAFASPIKENGKVVEYQSVRLCPSR
QHVDNADKLYKEIKAGKTPWQLKMPRTRLWQRLGLGFIVAAGVSFAADRFFAGAGLPLML
VLTILMAYQFTRRLETLSQEARKVFDNPLMELVYNGRVDDLSEIQLAMKMRQSELNAVVG
RIQDSSIQIGEAAKMSSQNSATTADNLDAQTRETEQLATAITQMNITATEIAHNAQAASD
ATVHAKNAARDGMHAVEQTVDAIGEMASQMKTASSVIEQLSSQSAMIGQVMEVIQSIAEQ
TNLLALNAAIEAARAGDQGRGFAVVADEVRKLAQRSTESTKEIQEVITSIQTSTRNAVET
IEQGNKLSVSCVDNAHLSGDKLTALLSQVSDITMRNEQIATAIEEMANVTEDMNRSVQSI
SDVSTETLGLAENTQNECRQLAHNLAQQTSLVAQFRRV