Protein Info for CSW01_18975 in Vibrio cholerae E7946 ATCC 55056

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 36 to 62 (27 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 102 to 118 (17 residues), see Phobius details amino acids 124 to 141 (18 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 309 to 326 (18 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 367 to 390 (24 residues), see Phobius details amino acids 396 to 416 (21 residues), see Phobius details PF07690: MFS_1" amino acids 40 to 374 (335 residues), 168.8 bits, see alignment E=1.7e-53 PF05977: MFS_3" amino acids 61 to 283 (223 residues), 30.1 bits, see alignment E=1.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_0267)

Predicted SEED Role

"Permease of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>CSW01_18975 MFS transporter (Vibrio cholerae E7946 ATCC 55056)
MSGLKGRENMGKSKEKGIESSESLFQWERVGRFNFPVWTVLIGTLFARTSFFMAWPFLVV
FLYQDYHATATEVGAMLATSALVGSLTGLYSGYLSDKFGRKWVMVSGTLIATFAYTGIGL
SNQIWQFFIMIVLTGLMRPMIEAPGKAVIGDNLPDEKDRELALNVRYFLLNLGGAIGPLI
GITLALAHPQVLFIVTGIAYFLFGLWLLATLERKGRFQQPDRSLLPNFSATLRVISKDNV
FVKMMLANFLMMFVYGQVESSLPQVIVRSGIADAAQLVAGLVLVNTMTIILFQFPTLKLL
ESVPLFTRTRLGMALMGLAQVGFMFTPEAFPLGWYLACFVLSMGEVIAFPTLNVQIDRLA
PAHLRGSYFGAAALYSLGFAIAPLAGGMMIEYLNAQWLYGLCFVLCLAMMGLYYLAQREQ
EMGEKERLSRATEC