Protein Info for CSW01_18940 in Vibrio cholerae E7946 ATCC 55056

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details PF00892: EamA" amino acids 8 to 136 (129 residues), 52.8 bits, see alignment E=2.6e-18

Best Hits

KEGG orthology group: None (inferred from 99% identity to vcm:VCM66_A0923)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>CSW01_18940 EamA family transporter (Vibrio cholerae E7946 ATCC 55056)
MPNHVLPVLFMLLSTFSLSLTGLLTQYLSHIIPITLLGFLRFIIPALFLLVAMKLTHFRW
PQRNMWFSLLIRAVCIAGSQLCFIYALQSLSLVESVVLFSTGPLFIPLLEKWLWGGQLAW
RTVLSVCIIFVGVVMLAGNTGSIEWRPELLAGLSAGLFNAGSQLSLYRAAQSDMRSIEIH
GWTFLVAALLLSPLLLLVPWSSDVGASLGMSWDISGAVTFAALLLSAILVVNTQVFRAKA
YRLAKSGSQLAPLIFTNLLFSALWQVLFFDVDYTLAQQVGLAVIIVTTVINGILPRLTER
KTRLKSA