Protein Info for CSW01_18930 in Vibrio cholerae E7946 ATCC 55056

Annotation: alpha-ketoglutarate-dependent dioxygenase AlkB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF13532: 2OG-FeII_Oxy_2" amino acids 23 to 199 (177 residues), 146.6 bits, see alignment E=5.4e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_A0921)

Predicted SEED Role

"Alkylated DNA repair protein AlkB" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>CSW01_18930 alpha-ketoglutarate-dependent dioxygenase AlkB (Vibrio cholerae E7946 ATCC 55056)
MMKKLFLDTHSASGEIKLTDGLLYWFPQFLTPIQADQAFQQMLTHLDWQQKSIRLFGKSV
LQPRLIAWYGEKGYRYSGLSLSAQPFPPPLLTLKTQCEQAAQAPFNSVLANLYRDGQDSM
GWHQDNEPELGSNPVIASLSLGESRRFLLRHHKDHALQVECELNHGDLLIMAGNTQHFWQ
HAIPKTRQTKQTRINLTFRNIL