Protein Info for CSW01_18715 in Vibrio cholerae E7946 ATCC 55056

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 63 to 83 (21 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 194 to 218 (25 residues), see Phobius details amino acids 250 to 276 (27 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details PF01032: FecCD" amino acids 19 to 336 (318 residues), 304.1 bits, see alignment E=5e-95

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to vcm:VCM66_A0874)

Predicted SEED Role

"Hemin ABC transporter, permease protein" in subsystem Hemin transport system or Iron acquisition in Vibrio or Putative hemin transporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>CSW01_18715 iron ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MLRRFPFAVTISCLTLAVFFAGLYSITVGPMNITISDSIQSLLFRSEQLTNAIHLVIHDI
RLPRTLLCLLVGAILALCGTAMQGLFRNPLAEPGIIGVSSGASLGAALAIVLLSDVVSSL
PWVNSLVLPIAAFIGGALTTVLVYRLGTSKFGTSVTIMLLAGVAISALAGAGIGYLNYLA
SDQMLRDLTLWSMGSVAGATTSSILLCSVTLIMLFAYFHWRSMALNALLLGEAEARHLGV
PVQKLKREMILLSAVGVGVAVSAAGMIGFVGLVVPHIGRMLVGPDHRNLVPVSTLLGALM
LTLADMVARVAVAPAELPIGIVTALVGAPFFLYLLFQQKGRIF