Protein Info for CSW01_18700 in Vibrio cholerae E7946 ATCC 55056

Annotation: biopolymer transporter exbB1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 13 to 31 (19 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 160 to 185 (26 residues), see Phobius details PF01618: MotA_ExbB" amino acids 72 to 194 (123 residues), 85.5 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 100% identical to EXBB1_VIBCH: Biopolymer transport protein exbB1 (exbB1) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 99% identity to vco:VC0395_0326)

Predicted SEED Role

"Ferric siderophore transport system, biopolymer transport protein ExbB" in subsystem Campylobacter Iron Metabolism or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>CSW01_18700 biopolymer transporter exbB1 (Vibrio cholerae E7946 ATCC 55056)
MESLQQLQQQLGLMAWPLFICSALTVMLLAERLFQVLLSLTVGKGAIRHALQATSPKNPK
QLAELTEHFASKRPVLYRGVAMLLAHHQFDKSLREDAAGIWLQEQRHQFNSGLRLLTLIG
VISPLLGLLGTVLGLIEMFKGVAATTGSITPNVLADGLGVAMYTTAAGLLIAVPAVAGAQ
LLSLWADRTMAKLEHTLNYVNLWLEGMTLHADASLTVVTPQEATTENL