Protein Info for CSW01_18695 in Vibrio cholerae E7946 ATCC 55056

Annotation: energy transducer TonB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF03544: TonB_C" amino acids 170 to 247 (78 residues), 90.5 bits, see alignment E=7.9e-30 TIGR01352: TonB family C-terminal domain" amino acids 171 to 247 (77 residues), 86.9 bits, see alignment E=4.5e-29 PF13103: TonB_2" amino acids 183 to 227 (45 residues), 23.2 bits, see alignment 6.2e-09

Best Hits

Swiss-Prot: 100% identical to TONB_VIBCH: Protein TonB (tonB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 100% identity to vch:VCA0910)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>CSW01_18695 energy transducer TonB (Vibrio cholerae E7946 ATCC 55056)
MREKDVNLNRYVIAGGLSLAFHALLLITTDEAQVFAMPAGNPTQSVSINMVSMPKVAPAQ
PEQTQTEQSKPESVKPTPVQEVVKTPPAKPKVKPHKPKPQTVKKPVPAEQVPSKSVAKPQ
PEKVERTAETAQKPAPTPNQQPSQPTAASQGITSQPILVDKPALVSAQVQPRYPRIARKR
GIEGTVMYEIWLDAQGNQIKQQLLSSSGTEALDQSALEAIKQWKFSPHILDGVPVAHRIH
IPIRFKLEG