Protein Info for CSW01_18685 in Vibrio cholerae E7946 ATCC 55056

Annotation: heme utilization cystosolic carrier protein HutX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 TIGR04108: putative heme utilization carrier protein HutX" amino acids 8 to 161 (154 residues), 220.9 bits, see alignment E=3.4e-70 PF06228: ChuX_HutX" amino acids 24 to 161 (138 residues), 131 bits, see alignment E=2.8e-42 PF05171: HemS" amino acids 28 to 156 (129 residues), 35.5 bits, see alignment E=9.2e-13

Best Hits

Swiss-Prot: 100% identical to HUTX_VIBCH: Intracellular heme transport protein HutX (hutX) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07227, hypothetical protein (inferred from 100% identity to vcj:VCD_000423)

Predicted SEED Role

"Putative heme iron utilization protein" in subsystem Iron acquisition in Vibrio

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (167 amino acids)

>CSW01_18685 heme utilization cystosolic carrier protein HutX (Vibrio cholerae E7946 ATCC 55056)
MESLQQQVAQLLEQQPTLLPAAMAEQLNVTEFDIVHALPEEMVAVVDGSHAQTILESLPE
WGPVTTIMTIAGSIFEVKAPFPKGKVARGYYNLMGRDGELHGHLKLENISHVALVSKPFM
GRESHYFGFFTAQGENAFKIYLGRDEKRELIPEQVARFKAMQQQHKQ