Protein Info for CSW01_18680 in Vibrio cholerae E7946 ATCC 55056

Annotation: heme utilization protein HutZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 TIGR04110: heme utilization protein HutZ" amino acids 4 to 171 (168 residues), 297.1 bits, see alignment E=1.6e-93 PF01243: PNPOx_N" amino acids 14 to 146 (133 residues), 82.3 bits, see alignment E=1.8e-27

Best Hits

Swiss-Prot: 100% identical to HUTZ_VIBCH: Heme oxygenase HutZ (hutZ) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07226, hypothetical protein (inferred from 99% identity to vcm:VCM66_A0867)

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase-related putative heme iron utilization protein" in subsystem Hemin transport system or Iron acquisition in Vibrio

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>CSW01_18680 heme utilization protein HutZ (Vibrio cholerae E7946 ATCC 55056)
MDQQVKQERLQGRLEPEIKEFRQERKTLQLATVDAQGRPNVSYAPFVQNQEGYFVLISHI
ARHARNLEVNPQVSIMMIEDETEAKQLFARKRLTFDAVASMVERDSELWCQVIAQMGERF
GEIIDGLSQLQDFMLFRLQPEQGLFVKGFGQAYQVSGDDLVDFVHLEEGHRKISNG