Protein Info for CSW01_18665 in Vibrio cholerae E7946 ATCC 55056

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 44 (18 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 361 to 381 (21 residues), see Phobius details amino acids 388 to 411 (24 residues), see Phobius details amino acids 427 to 449 (23 residues), see Phobius details PF02447: GntP_permease" amino acids 1 to 448 (448 residues), 323 bits, see alignment E=2.9e-100

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_0333)

Predicted SEED Role

"D-glycerate transporter (predicted)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>CSW01_18665 permease (Vibrio cholerae E7946 ATCC 55056)
MSLILILLAVIVFIVLATTKFKVHPFLALLLAAFLGAFAYGLPADTIAKTITTGFGGILG
YIGLVIVLGTIIGVILEKSGAAITMADTVIKLLGERFPTLTMSIIGYIVSIPVFCDSGFV
ILNSLKESLAKRLATSSVAMSVALATGLYATHTFVPPTPGPIAAAGNLGLESQLGLVIAI
GLFVAAVAAIAGMLWANRFQAVEADIIDSQESPKKDWQALKASYGQLPSASQAFAPIFVP
ILLICFGSIAKFPSFPFGQGMLFEVLGFLGQPLTALLIGLLLAVRLLKSADKVAEFGERI
SQGITAAAPILLITGAGGAFGAVLKATPLGDYLGTTLSALGVGIFMPFIVAAALKSAQGS
STVALVTTSALVAPLLGQLGLDSEMGRALTVMAIGAGAMTVSHANDSFFWVVSQFSRMSV
GLAYRAQTMATLVQGGTAMAVVYVLSLVLL