Protein Info for CSW01_18630 in Vibrio cholerae E7946 ATCC 55056

Annotation: 6-phosphogluconolactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01182: Glucosamine_iso
  • amino acids 10 to 227 (218 residues), 220.4 bits, E=1.4e-69
• TIGR01198: 6-phosphogluconolactonase
  • amino acids 11 to 237 (227 residues), 181.1 bits, E=1.2e-57

Best Hits

Swiss-Prot: 62% identical to 6PGL_AGGAC: 6-phosphogluconolactonase (pgl) from Aggregatibacter actinomycetemcomitans

KEGG orthology group: K01057, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 100% identity to vco:VC0395_0340)

Predicted SEED Role

"6-phosphogluconolactonase (EC 3.1.1.31), eukaryotic type" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 3.1.1.31)

MetaCyc Pathways

• superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
• pentose phosphate pathway (8/8 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)
• heterolactic fermentation (13/18 steps found)
• formaldehyde oxidation I (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.31

Protein Sequence (238 amino acids)

>CSW01_18630 6-phosphogluconolactonase (Vibrio cholerae E7946 ATCC 55056)
MINHKIFPTADAVVKSLADDMLAYSQQGQPVHISLSGGSTPKMLFKLLASQPYANDIQWK
NLHFWWGDERCVAPDDAESNYGEANALLFSKINMPAQNIHRILGENEPQAEAERFAQAMA
HVIPTENGTPVFDWILLGVGADGHTASLFPGQTDYADANLSVVASHPESGQLRVSKTAKV
LQAAKRISYLVLGAGKAEIVEQIHTTPAEQLPYPAAKIHSTSGVTEWYLDSDAAAKIA