Protein Info for CSW01_18625 in Vibrio cholerae E7946 ATCC 55056

Annotation: glucose-6-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 TIGR00871: glucose-6-phosphate dehydrogenase" amino acids 7 to 487 (481 residues), 658.5 bits, see alignment E=3.1e-202 PF00479: G6PD_N" amino acids 11 to 192 (182 residues), 220.5 bits, see alignment E=2.9e-69 PF02781: G6PD_C" amino acids 194 to 487 (294 residues), 394.1 bits, see alignment E=3.5e-122

Best Hits

Swiss-Prot: 68% identical to G6PD_HAEIN: Glucose-6-phosphate 1-dehydrogenase (zwf) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 100% identity to vch:VCA0896)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>CSW01_18625 glucose-6-phosphate dehydrogenase (Vibrio cholerae E7946 ATCC 55056)
MMVIPENSSIVIFGASGDLTYRKLIPALYHLYASQQLPKSFAILGVSRTEYSDESYREKL
KRSLQELEKTEPAALEAFMQHVHYQALNTSEVADYQHLATRLDTLANDYQFEQRNTLFYL
ATPPSLYGVIPACLAAHGLNDESQGWKRLIIEKPFGYDLQSAQDLDVEIHHHFKEHQIYR
IDHYLGKETVQNLLVFRFANGMFEPLWNRNFIDYVEITGAEFLGVEERGGYYDGSGAVRD
MFQNHLLQVLAMVGMEPPAAINADSIRNEVNKVLQSLQPLSESDLRNNLVLGQYTESEVR
GQFLPSYRNEPGVAADSRTETYVALKMFINNWRWNGVPFYVRSGKRLPTRVTEVVIHFKR
TPHPVFGQNAPENKLIIRIQPDEGILMSFGLKEPGAGFKAKEVSMNFHYASLEQIKMLTA
YERLLLDALNGDATLFARTDAVEACWKFVQPILDFKQDPQSLYGYACGTWGPKESDDLLR
RDGREWRFPCKNLTNTDYCEL