Protein Info for CSW01_18585 in Vibrio cholerae E7946 ATCC 55056

Annotation: LuxR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 TIGR03541: LuxR family transcriptional regulatory, chaperone HchA-associated" amino acids 18 to 248 (231 residues), 378.1 bits, see alignment E=7.5e-118 PF03472: Autoind_bind" amino acids 35 to 170 (136 residues), 46.5 bits, see alignment E=4.4e-16 PF00196: GerE" amino acids 187 to 242 (56 residues), 44.6 bits, see alignment E=1.3e-15 PF08281: Sigma70_r4_2" amino acids 188 to 230 (43 residues), 32.2 bits, see alignment 1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_0350)

Predicted SEED Role

"transcriptional regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>CSW01_18585 LuxR family transcriptional regulator (Vibrio cholerae E7946 ATCC 55056)
MLKLSRNKIEQKEPMPAVDLITLISQLEESHSFSTVQDIVRQRAHFYGYDKIVFFSAHST
LDGIIERIYWIEGDWFDDGENIDAATYIKYCPITRHIIETDRPFFWTKKPDVNREQYRVV
AKPKGSGIHGLQIPIFGHLGLEGAVSLGGKAIDSSPRARCELSLLSTYAFFAARRLLESS
DPNRSALLSKREKEVLSLTALGRRQADIAIALGVSPRTIENHLRNARLKLGGATTAETIR
IAIQRGDINSHSI