Protein Info for CSW01_18405 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details PF12704: MacB_PCD" amino acids 23 to 249 (227 residues), 50.2 bits, see alignment E=4.2e-17 PF02687: FtsX" amino acids 286 to 411 (126 residues), 67.7 bits, see alignment E=1e-22

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to vch:VCA0854)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>CSW01_18405 ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MGKLISQAWRLAALNLQRNRRRSLLSISIIAIAVLALTSAGGFGLYTYDSLRESTARDVG
HLTLSQRGYFAQEEETPLANGLEGSDHIRQVLLANPAIRGIQPRIELTGLVSNGQKSTIF
VGLGVDDKEFDMKGPFLDLRAGQTLQDPKSPRFDPTQPQVMLGVDLARNLSVGVGDWVTL
LATTADGALNALDFQVRGLYSTGVPELDKRQLYLHLASAQELLNSSKVSTLSVYLFNTEN
TQTLQTWVENQLNQLSLSQELQVTPWQQLAFFYTRVKDLYDRLFGVMGTVMAMVVFVALF
NTLTMSVSERTREIGTLSALGAYPSDILAGFVREATLLALCGSLLGTLLTGITIVAVRVA
DIQMPPPPGRTEGYPLDLYFSFTLVGFCTLGTVLICVLAAWFSARKGVNKPITEALAYV