Protein Info for CSW01_18370 in Vibrio cholerae E7946 ATCC 55056

Annotation: L-methionine/branched-chain amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 87 to 111 (25 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 217 to 242 (26 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details amino acids 376 to 404 (29 residues), see Phobius details PF13520: AA_permease_2" amino acids 19 to 366 (348 residues), 102.6 bits, see alignment E=2.4e-33 PF00324: AA_permease" amino acids 21 to 403 (383 residues), 70.6 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 99% identity to vco:VC0395_0390)

Predicted SEED Role

"Amino acid transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>CSW01_18370 L-methionine/branched-chain amino acid transporter (Vibrio cholerae E7946 ATCC 55056)
MNQLKKDISLGAGIAQLSTTLMGTGLFMVPAIAAGIAGVFSLWAWLLLFVAICPIALTFA
QLGKRYPNAGGTAYFVRQAFNPRLERAVAWLFLSVIPVGVPAAVTLAASFLQALLPAPLA
NPLLTQTLTILLLVGVNLAGTKSSGRLQTLIALAIFSLVIAFWWRGEVTTQDLVMPALTQ
EGWVSIGAALAVMFWCFVGIEAFAHMGEEFRNPQRDFPLAILIGSFVAGLTYWACSVVVL
KFSAFGTPQFDSGAIPWLSDQLFGTRWAIMISVIGFLACFASLNLYTQSLARMVWAQARE
YRPESAIARVSIRGVPAHATLLVGVVLFASCFIGHLTGLDLEFFLKLANGIFVLVYLLAM
LAAFKLLTGWSKHLAGLALVLCAGVFLCLGWSMLYALGVFVLLIRPWQVRVQTI