Protein Info for CSW01_18335 in Vibrio cholerae E7946 ATCC 55056

Annotation: sugar O-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF12464: Mac" amino acids 8 to 57 (50 residues), 36.3 bits, see alignment E=8.2e-13 PF14602: Hexapep_2" amino acids 129 to 163 (35 residues), 34.7 bits, see alignment 1.8e-12 PF00132: Hexapep" amino acids 130 to 163 (34 residues), 36.6 bits, see alignment 3.8e-13

Best Hits

Swiss-Prot: 41% identical to ATRF2_STAHJ: Putative acetyltransferase SH0499 (SH0499) from Staphylococcus haemolyticus (strain JCSC1435)

KEGG orthology group: K00661, maltose O-acetyltransferase [EC: 2.3.1.79] (inferred from 100% identity to vco:VC0395_0399)

MetaCyc: 41% identical to maltose O-acetyltransferase (Escherichia coli K-12 substr. MG1655)
Maltose O-acetyltransferase. [EC: 2.3.1.79]

Predicted SEED Role

"Maltose O-acetyltransferase (EC 2.3.1.79)" in subsystem Maltose and Maltodextrin Utilization (EC 2.3.1.79)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>CSW01_18335 sugar O-acetyltransferase (Vibrio cholerae E7946 ATCC 55056)
MKMSELEKMLKGEHFDGASAEIEALRSQAGRLKLEINQSLDEAERYALQRELFGHLGHKS
CVQPPFHCEFGKTIRIGDHTFINMNVVMLDGAPITIGDHVLIGPSTQFYTASHSLDYRRR
QAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARIL
RSLKDPAESMAE