Protein Info for CSW01_18290 in Vibrio cholerae E7946 ATCC 55056

Annotation: phenylalanine 4-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00351: Biopterin_H
  • amino acids 13 to 229 (217 residues), 164 bits, E=2.5e-52
• TIGR01267: phenylalanine-4-hydroxylase
  • amino acids 13 to 252 (240 residues), 330 bits, E=4e-103

Best Hits

Swiss-Prot: 100% identical to PH4H_VIBCH: Phenylalanine-4-hydroxylase (phhA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00500, phenylalanine-4-hydroxylase [EC: 1.14.16.1] (inferred from 100% identity to vco:VC0395_0407)

Predicted SEED Role

"Phenylalanine-4-hydroxylase (EC 1.14.16.1)" in subsystem Aromatic amino acid degradation or Pterin biosynthesis (EC 1.14.16.1)

MetaCyc Pathways

• L-phenylalanine degradation V (3/3 steps found)
• L-phenylalanine degradation I (aerobic) (1/1 steps found)
• L-tyrosine biosynthesis IV (1/1 steps found)

KEGG Metabolic Maps

• Phenylalanine metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.16.1

Protein Sequence (264 amino acids)

>CSW01_18290 phenylalanine 4-monooxygenase (Vibrio cholerae E7946 ATCC 55056)
MTQYHSKPVSEHGHIDWDQDEHAVWHELITRQQEVVKTRACQAYLDGLNMLNLPTDRLPQ
LPEINRVLQRETGWQVEPVPALISFDRFFALLADKKFPVATFLRRREEFDYLQEPDFFHE
VYGHCAMLTHPDFAAFTHVYGQLGAKATPKERSYLARLYWFTVEFGLVQEQGQTKIYGGG
ILSSPGETLYASESTIPKREPFDIMQVLRTPYRIDIMQPIYYVLPDLSQLYQLSQRDVMA
LVWQAMQDGLLPPLFQPKEQQHAG