Protein Info for CSW01_18285 in Vibrio cholerae E7946 ATCC 55056

Annotation: 4a-hydroxytetrahydrobiopterin dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01329: Pterin_4a
  • amino acids 17 to 108 (92 residues), 105.8 bits, E=5.2e-35

Best Hits

Swiss-Prot: 100% identical to PHS_VIBCH: Putative pterin-4-alpha-carbinolamine dehydratase (VC_A0827) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01724, 4a-hydroxytetrahydrobiopterin dehydratase [EC: 4.2.1.96] (inferred from 99% identity to vco:VC0395_0408)

Predicted SEED Role

"Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)" in subsystem Pterin biosynthesis (EC 4.2.1.96)

MetaCyc Pathways

• L-phenylalanine degradation V (3/3 steps found)
• tetrahydropteridine recycling (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.96

Protein Sequence (109 amino acids)

>CSW01_18285 4a-hydroxytetrahydrobiopterin dehydratase (Vibrio cholerae E7946 ATCC 55056)
MLDELRCEACSAGAIGLTSEEQQQLLSELDGWALIHRDGIAQLEKRYRFKNFKQAWAFSN
QIAELAEQEFHNPAILLEWGNVTVTWWSHSIKGLHKNDFICAAKCDALT