Protein Info for CSW01_18280 in Vibrio cholerae E7946 ATCC 55056

Annotation: L-2,4-diaminobutyric acid acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR02406: diaminobutyrate acetyltransferase" amino acids 16 to 169 (154 residues), 192.9 bits, see alignment E=1.7e-61 PF13302: Acetyltransf_3" amino acids 44 to 135 (92 residues), 29.2 bits, see alignment E=2.8e-10 PF00583: Acetyltransf_1" amino acids 52 to 135 (84 residues), 55.2 bits, see alignment E=1.7e-18 PF13673: Acetyltransf_10" amino acids 53 to 127 (75 residues), 25.7 bits, see alignment E=1.9e-09 PF13508: Acetyltransf_7" amino acids 55 to 135 (81 residues), 38.1 bits, see alignment E=3.3e-13

Best Hits

Swiss-Prot: 100% identical to ECTA_VIBCH: L-2,4-diaminobutyric acid acetyltransferase (ectA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06718, L-2,4-diaminobutyric acid acetyltransferase [EC: 2.3.1.178] (inferred from 100% identity to vch:VCA0825)

Predicted SEED Role

"L-2,4-diaminobutyric acid acetyltransferase (EC 2.3.1.-)" in subsystem Ectoine biosynthesis and regulation (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.178

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>CSW01_18280 L-2,4-diaminobutyric acid acetyltransferase (Vibrio cholerae E7946 ATCC 55056)
MIYPQIMHKPALPWVFRRPTQEDGLSIHELIAQCAPLDQNSAYCNFLQSSHFQTTCLMAE
QQELLVGFVSAYRKPEQQNELFIWQVAVHPSARGKGLAYQMLKHLLAREDLADITVLETT
ITRSNQASWRLFQKLDREQGEQGSVSTFLDETCHFEGEHDTEYLYRIPLQSSN