Protein Info for CSW01_18270 in Vibrio cholerae E7946 ATCC 55056
Annotation: L-ectoine synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to ECTC_VIBCH: L-ectoine synthase (ectC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
KEGG orthology group: K06720, L-ectoine synthase [EC: 4.2.1.108] (inferred from 100% identity to vco:VC0395_0411)MetaCyc: 56% identical to ectoine synthase monomer (Halomonas elongata DSM 2581)
Ectoine synthase. [EC: 4.2.1.108]
Predicted SEED Role
"L-ectoine synthase (EC 4.2.1.-)" in subsystem Ectoine biosynthesis and regulation (EC 4.2.1.-)
MetaCyc Pathways
- ectoine biosynthesis (5/5 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Fatty acid biosynthesis
- Glycine, serine and threonine metabolism
- Limonene and pinene degradation
- Nucleotide sugars metabolism
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Porphyrin and chlorophyll metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.-
Use Curated BLAST to search for 4.2.1.- or 4.2.1.108
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (138 amino acids)
>CSW01_18270 L-ectoine synthase (Vibrio cholerae E7946 ATCC 55056) MIVRTLEECRQSERRVVAENWESVRMLLKDDHMGFSFHITTIYANTQTHIHYRNHLESVY CMSGEGEIEVVGGKTYPIQPGTLYILDQHDEHYLRAFSSEMVMACVFNPPLTGHEIHDAE GVYPLDKSELISQCHKEK