Protein Info for CSW01_17995 in Vibrio cholerae E7946 ATCC 55056

Annotation: DUF3763 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 PF20030: bpMoxR" amino acids 18 to 207 (190 residues), 189.6 bits, see alignment E=1.1e-59 PF07728: AAA_5" amino acids 50 to 179 (130 residues), 89.9 bits, see alignment E=4.7e-29 PF00004: AAA" amino acids 51 to 185 (135 residues), 21.6 bits, see alignment E=8e-08 PF17868: AAA_lid_8" amino acids 234 to 312 (79 residues), 81.7 bits, see alignment E=7.9e-27 PF20265: LARA_dom" amino acids 372 to 466 (95 residues), 100 bits, see alignment E=2.8e-32 PF12592: ATPase_RavA_C" amino acids 482 to 534 (53 residues), 69.5 bits, see alignment 6.1e-23

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 100% identity to vco:VC0395_0704)

Predicted SEED Role

"Putative regulator protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>CSW01_17995 DUF3763 domain-containing protein (Vibrio cholerae E7946 ATCC 55056)
MLQPTHSSHARKALLSERINKLAKALSDGVYERENTIKLCLLTALAGESVFLLGPPGIAK
SLIAKRLIQAFDNSSYFEYLMTRFSTPEEVFGPLSIQELKDNGRYVRLTQGYLPTAQVVF
LDEIWKAGPAILNTLLTVVNEKTFKNGSDIERVPMRLLVTASNELPDEDSGLEALYDRML
VRIFVNRIQNKQNFKSMLTVGTAQEAQIPAGLAITDEEYHQWQQQLDKLELSDDVFEKLY
QLKTMVEERSKESAGSDLEMYVSDRRWKKAAKLLKASAFFNGRDEINPLDLLLLQNCLWN
TPESHDVVHEVIREFALRYAFDQAEVEQQLDVCRLELAQIQEELESEFAMVLSLETTNGL
IKKQVHHQYDLSDAKIYKVGMTPDLIKLVLLQSNMSVSEGEKGDSRWIYVQKSELERVIK
EGHGEAYGYVNQNTNLCRLRFDLDASNNLVIKDIANRSVLLAMVTKQGLDESLYQNWLTK
ADQAMAQLTHAEHHLRKVRLKFHDALPHSFIDPELPTAMQATLHELQQQLDATQVECERN
VMRIRNLNQFFA