Protein Info for CSW01_17935 in Vibrio cholerae E7946 ATCC 55056

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 354 to 371 (18 residues), see Phobius details PF07690: MFS_1" amino acids 16 to 341 (326 residues), 100.1 bits, see alignment E=1.9e-32 PF06779: MFS_4" amino acids 31 to 359 (329 residues), 45.1 bits, see alignment E=1.4e-15 PF00083: Sugar_tr" amino acids 44 to 118 (75 residues), 28.8 bits, see alignment E=9.1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to vch:VCA0753)

Predicted SEED Role

"Permease of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>CSW01_17935 MFS transporter (Vibrio cholerae E7946 ATCC 55056)
MEIHSSAPNRIAVPVIALTLYAIAAGYLMSLVPLMLPHYQLESDLASWLASVFYAGLLAG
ALVAEPFVNRLGHRKAFVWCLSLLQLSIVVMPLLPYASVWLLARLVAGIAVAGIFVVVES
WLLHGDEQGRAKRLGIYMVSLYGGTALGQMAIGQLGVAGAVPFIAITTLLLIASIVLMYV
DSDQPSTQQASSLSLRQIFKLSKAAMIGCLVSGLTLGAIYGLMPVELANRGISHTDLGNL
MALVILGGMAVQPLVPWLSKFLGRTLQMALFCLLGTAAITLTVFDDSLLVLGVSLFILGM
ATFALYPIAINLGCDKLDASYIVSATQVMLLSYSVGSVVGPVLADCFMQDRHGLMAYLFA
ILLATCLYMLIKSVKTKRQWVAGE