Protein Info for CSW01_17930 in Vibrio cholerae E7946 ATCC 55056

Annotation: thioredoxin TrxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21352: Thio2_N
  • amino acids 8 to 32 (25 residues), 44.2 bits, 2.8e-15
• PF00085: Thioredoxin
  • amino acids 43 to 139 (97 residues), 95.8 bits, E=2.9e-31
• TIGR01068: thioredoxin
  • amino acids 45 to 141 (97 residues), 117 bits, E=1.9e-38
• PF13098: Thioredoxin_2
  • amino acids 53 to 138 (86 residues), 42.2 bits, E=1.8e-14

Best Hits

Swiss-Prot: 56% identical to THIO2_ECO57: Thioredoxin 2 (trxC) from Escherichia coli O157:H7

KEGG orthology group: K03672, thioredoxin 2 [EC: 1.8.1.8] (inferred from 100% identity to vco:VC0395_0690)

MetaCyc: 56% identical to reduced thioredoxin 2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Thioredoxin 2 (EC 1.8.1.8)" (EC 1.8.1.8)

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Protein Sequence (144 amino acids)

>CSW01_17930 thioredoxin TrxC (Vibrio cholerae E7946 ATCC 55056)
MSTFNTRCPSCHSLNRVPEERITESPNCGKCQSALLDGAPIEGTEANFSALLQSDKPVVV
DFWAPWCNPCVGFAPIFSDVAAERKGQIRCVKIDTEAQQNLAAHFQIRSIPTIMVFKNGQ
RIDMINGALPKSQFDQWLNQALTK