Protein Info for CSW01_17905 in Vibrio cholerae E7946 ATCC 55056

Annotation: aquaporin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00230: MIP
  • amino acids 5 to 252 (248 residues), 195.2 bits, E=6.9e-62
• TIGR00861: MIP family channel proteins
  • amino acids 15 to 252 (238 residues), 223.8 bits, E=1.2e-70

Best Hits

Swiss-Prot: 68% identical to GLPF_HAEIN: Glycerol uptake facilitator protein (glpF) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02440, glycerol uptake facilitator protein (inferred from 100% identity to vco:VC0395_0683)

MetaCyc: 67% identical to glycerol facilitator (Escherichia coli K-12 substr. MG1655)
RXN0-7189; RXN0-7191; TRANS-RXN-131; TRANS-RXN0-460; TRANS-RXN0-536; TRANS-RXN0-537; TRANS-RXN0-551

Predicted SEED Role

"Glycerol uptake facilitator protein" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerol fermenation to 1,3-propanediol

MetaCyc Pathways

• glycerol and glycerophosphodiester degradation (4/4 steps found)
• glycerol degradation I (3/3 steps found)
• arsenate detoxification III (2/2 steps found)
• arsenic detoxification (plants) (3/6 steps found)
• arsenic detoxification (mammals) (8/17 steps found)
• arsenic detoxification (yeast) (4/12 steps found)

Protein Sequence (284 amino acids)

>CSW01_17905 aquaporin family protein (Vibrio cholerae E7946 ATCC 55056)
MNQTKQHTLLGQCIAEFIGTGLLIFFGVGCVAALVLAGAQFGQWEISIVWGFGVSIAIYC
TAGVSGAHINPAVTIALAAFHGFDKAKVLPYIVSQVAGAFCAAALVYSLYSNLFTDYEIA
HNFVRSSQEALATAGIFSTYPHASLSFMGAMAVEFTITAVLMFAILALGDENNGAHRNAM
NPLLIGILIAVIGGSLGPLTGFAMNPARDFGPKLFAYFAGWDYALTGAKEIPYFIVPIVA
PILGACFGAWAYPKFIAAYLPKTGTGCTIPNQCDTAEESEEARA