Protein Info for CSW01_17735 in Vibrio cholerae E7946 ATCC 55056

Annotation: methylglyoxal synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 TIGR00160: methylglyoxal synthase" amino acids 11 to 150 (140 residues), 215.7 bits, see alignment E=1.2e-68 PF02142: MGS" amino acids 26 to 118 (93 residues), 61.7 bits, see alignment E=2.9e-21

Best Hits

Swiss-Prot: 100% identical to MGSA_VIBCM: Methylglyoxal synthase (mgsA) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K01734, methylglyoxal synthase [EC: 4.2.3.3] (inferred from 100% identity to vcm:VCM66_A0669)

MetaCyc: 67% identical to methylglyoxal synthase (Escherichia coli K-12 substr. MG1655)
Methylglyoxal synthase. [EC: 4.2.3.3]

Predicted SEED Role

"Methylglyoxal synthase (EC 4.2.3.3)" in subsystem Methylglyoxal Metabolism (EC 4.2.3.3)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>CSW01_17735 methylglyoxal synthase (Vibrio cholerae E7946 ATCC 55056)
MKKTTRTMAAHKHVALVAHDNCKGELLRWVTENKEKLQRHFLYATGTTGHMLSKETGLAI
KSMISGPMGGDQQLGALISEGKIDVLIFFWDPLNAVPHDPDVKALLRIASVWNIPVATNR
ASAKFLFSSSLMEQEVQIEIPDYQAYLAERT