Protein Info for CSW01_17730 in Vibrio cholerae E7946 ATCC 55056

Annotation: TMAO reductase system periplasmic protein TorT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 46 to 301 (256 residues), 99 bits, see alignment E=3.5e-32 TIGR02955: TMAO reductase system periplasmic protein TorT" amino acids 47 to 345 (299 residues), 486.8 bits, see alignment E=1.1e-150 PF13407: Peripla_BP_4" amino acids 53 to 307 (255 residues), 63 bits, see alignment E=3.4e-21

Best Hits

Swiss-Prot: 45% identical to TORT_ECOLI: Periplasmic protein TorT (torT) from Escherichia coli (strain K12)

KEGG orthology group: K11930, periplasmic protein TorT (inferred from 100% identity to vcj:VCD_000609)

Predicted SEED Role

"Periplasmic protein torT precursor" in subsystem trimethylamine N-oxide (TMAO) reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>CSW01_17730 TMAO reductase system periplasmic protein TorT (Vibrio cholerae E7946 ATCC 55056)
MADWAILCSVYSGSPTNNLMPNLRLHSFSLISALLLLSALPAAAAEKLCALYPHLKDSYW
LSVNYGMVEEARKLNLNLRVMEAGGYPNHHKQQQQIALCVRWGADAILLGTVSPELYQDD
LAHYTRSVPVFATVNQLRLNEQQQEHLKGEVGVDWYWMGFYAGEYLARKHPKGSGEIKIV
VLPGPASSGGTKPVLQGLEEAISHSDVRITEILWADNDKELQRNLIQQALEQPDVRYLVG
SAVAIEAAISELRSLNKSDQIGLIATYLSHGVYRGLLRGRVEFAPTDQMVEQGRLSVRQA
AAFLRNKPYAIQQAPKIEALTPQHLERKIIADSLSPSEYRPVFQVKAVE