Protein Info for CSW01_17715 in Vibrio cholerae E7946 ATCC 55056

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 101 to 126 (26 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 320 to 337 (18 residues), see Phobius details amino acids 345 to 368 (24 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details amino acids 419 to 438 (20 residues), see Phobius details PF07690: MFS_1" amino acids 36 to 392 (357 residues), 176.7 bits, see alignment E=3.1e-56

Best Hits

KEGG orthology group: K07783, MFS transporter, OPA family, sugar phosphate sensor protein UhpC (inferred from 100% identity to vcj:VCD_000612)

Predicted SEED Role

"Phosphoglycerate transporter protein PgtP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>CSW01_17715 MFS transporter (Vibrio cholerae E7946 ATCC 55056)
MLNFFKTRPDLPLLSSSKAEMLKRYKSYQWQVFIGLIFGYAMFYVVRMALGVVKKPMLDA
GIVTLEELGIMGSAFFFTYAFGKFLNGFLSDYANIGRFMSFSLLLSGVASIFMGMNTVAF
FFVLLWGLNGWFQSVGSAPSCVSIYQWFSPKQRGSRYSIWGGSRNIGEGITWILTASLVS
YFGWRAGFIGAGIAGVVASLIMFKLLKDRPQTYGMPDPGTAFEEGTEIKKANDPKETRRA
QMFILKQPVVWLIALACAAMYISRYAMSSWAVLFLQEQKGYSLIDAGFAMSMYPTAGLAG
AILSGILSDKVFKGNRNIPNLLYGLTNIAGMCLMFFGPDNRIVDAVALSMIGFSIGGLVV
FLAGLIACDLMPKNAVGAVKGLIGLCSYIAASAQELISASLITVTEVEGVKHYDFGNAQY
FWLAAGVVSVLLALTVWNAKKVVDIDEAEGKPLKTQTAS