Protein Info for CSW01_17655 in Vibrio cholerae E7946 ATCC 55056

Annotation: protein translocase subunit SecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details PF07549: Sec_GG" amino acids 30 to 47 (18 residues), 25 bits, see alignment (E = 1e-09) TIGR00966: protein-export membrane protein SecF" amino acids 35 to 276 (242 residues), 215.9 bits, see alignment E=7.5e-68 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 68 to 274 (207 residues), 164.9 bits, see alignment E=2.3e-52 PF02355: SecD_SecF_C" amino acids 101 to 282 (182 residues), 188.6 bits, see alignment E=8e-60

Best Hits

KEGG orthology group: K03074, preprotein translocase subunit SecF (inferred from 100% identity to vco:VC0395_0632)

Predicted SEED Role

"Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>CSW01_17655 protein translocase subunit SecF (Vibrio cholerae E7946 ATCC 55056)
MVDYLKSRIRPIRYITGIISVLLMVISLGAFAIKGLNMGLDFTGGMVTEAIINHSVTKSQ
LMDQLQPVLGESVSATPSGEEGRWVIRYPLAAEDATPVDIATELHHISDQVQIVSNSMVG
SQVGQELIDQGGLALLICLLSILAYLSFRFEWRLASGALLALLHDVILVLGFFAITQMEF
NLTVFAAVLAVLGYSLNDSIIISDRIRELLLAKQQTPTADINDQAIIATFSRTMVTSGTT
LMTISALWLMGGAPLQGFAIAMFIGIISGTWSSISIGTVLPEWLGLESKHYLPVELDAAP