Protein Info for CSW01_17650 in Vibrio cholerae E7946 ATCC 55056

Annotation: beta-ketoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01829: acetoacetyl-CoA reductase
  • amino acids 3 to 245 (243 residues), 408 bits, E=7.3e-127
• PF00106: adh_short
  • amino acids 3 to 197 (195 residues), 190.1 bits, E=6.2e-60
• PF01370: Epimerase
  • amino acids 5 to 142 (138 residues), 36 bits, E=1.1e-12
• PF08659: KR
  • amino acids 6 to 176 (171 residues), 69.1 bits, E=9.2e-23
• PF13561: adh_short_C2
  • amino acids 11 to 243 (233 residues), 196.1 bits, E=1.5e-61

Best Hits

Swiss-Prot: 54% identical to NODG_AZOBR: Nodulation protein G (nodG) from Azospirillum brasilense

KEGG orthology group: K00023, acetoacetyl-CoA reductase [EC: 1.1.1.36] (inferred from 100% identity to vcm:VCM66_A0649)

MetaCyc: 52% identical to (R)-3-hydroxybutyryl-CoA dehydrogenase (Cereibacter sphaeroides)
Acetoacetyl-CoA reductase. [EC: 1.1.1.36]

Predicted SEED Role

"Acetoacetyl-CoA reductase (EC 1.1.1.36)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle (EC 1.1.1.36)

MetaCyc Pathways

• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (5/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• polyhydroxybutanoate biosynthesis (2/3 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (2/4 steps found)
• acetyl-CoA fermentation to butanoate (4/7 steps found)
• 4-oxopentanoate degradation (2/9 steps found)
• ethylmalonyl-CoA pathway (2/11 steps found)

KEGG Metabolic Maps

• Butanoate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.36

Protein Sequence (246 amino acids)

>CSW01_17650 beta-ketoacyl-ACP reductase (Vibrio cholerae E7946 ATCC 55056)
MRKIALITGSKGGIGSAISTQLVSEGYRVIATYYTGNYQCALDWFNEKQFTEDQVRLLEL
DVTNTEECAERLAKLLEEEGTIDVVVNNAGITRDSVFKKMPHQAWKEVIDTNLNSVFNVT
QPLFAAMCEKGFGRIINISSVNGLKGQFGQTNYSAAKAGMIGFSKALAAEGARYGVTVNV
IAPGYTLTPMVEQMRAEVLQSIVDQVPMKRLAKPEEIANAVSYLASDAAAYITGETLSVN
GGLYMR